SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C4EZF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1C4EZF6
Domain Number - Region: 155-195
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 0.0418
Family HIN-200/IF120x domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1C4EZF6
Sequence length 273
Comment (tr|A0A1C4EZF6|A0A1C4EZF6_BACCE) HNH endonuclease {ECO:0000313|EMBL:PER25953.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=CN490_19685 OC=Bacillus cereus group.
Sequence
MTQCIICRKDTKELSEQYVIPEILCGYYFTNSICDTCHEQMTTNIDRPLIRHKLSQFKIE
QMKKQIDSPLYTNEHGEELAAAETDVVEVSDEILYSNALIMKLCKKHDISLHNEIWKEER
VTKVASSIQRELLLDNRKYKMSVLKMAYTFAVQAVDGYFEDPDAIDISNILSNGDFMELK
EKSIVRDLSKSSLWNTLNTNSENHYFILLSDKDGLFCFIRLFDIFDVVVHLSEKRYELSS
PIVGVNDVNRQEFYVQTLKQYMDGLFKEKKPSI
Download sequence
Identical sequences A0A1C4EZF6 A0A1E8AJ68 A0A2B6UYC6 J9AQU2
WP_000189697.1.31387 WP_000189697.1.52932 WP_000189697.1.59075 WP_000189697.1.61481 WP_000189697.1.69703 WP_000189697.1.82566 WP_000189697.1.8365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]