SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C4IQH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C4IQH4
Domain Number 1 Region: 7-74
Classification Level Classification E-value
Superfamily MbtH-like 1.57e-32
Family MbtH-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C4IQH4
Sequence length 91
Comment (tr|A0A1C4IQH4|A0A1C4IQH4_9ACTN) MbtH protein {ECO:0000313|EMBL:SCD39117.1} KW=Complete proteome OX=1838282 OS=Streptomyces sp. BvitLS-983. GN=GA0115250_10556 OC=Streptomyces.
Sequence
MRKGKLMENPFDDDNGIFYVLVNDENQHSLWPTFAKVPDGWTVVFGEDSRQNCLDYVEKN
WTDMRPASLIREMDGVPATSRGTAAQTAVPA
Download sequence
Identical sequences A0A0S1UQ52 A0A126Y569 A0A1C4IMU2 A0A1C4IQH4 A0A1C4NM66

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]