SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C4R7U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C4R7U9
Domain Number 1 Region: 12-146
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase II 2.25e-45
Family Peptidyl-tRNA hydrolase II 0.0000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1C4R7U9
Sequence length 146
Comment (tr|A0A1C4R7U9|A0A1C4R7U9_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:SCE31000.1} KW=Complete proteome OX=1839767 OS=Streptomyces sp. IgraMP-1. GN=GA0115236_147412 OC=Streptomyces.
Sequence
MTTNANDTAPVRFDTKIAVLLRDDLAGWQRLNVTAFLVSGLGTRHPEVIGEPYEDADSTT
YLPMLRQPVLVFEGSKETLTAAHGKALARALPRAVFTSDLFATGNDRDNRAAVRAVGKDS
LDLVGLAVYGPRNAVDKVLKGARMHP
Download sequence
Identical sequences A0A0X3WQ20 A0A1C4R7U9
WP_018893625.1.51302 WP_018893625.1.52204 WP_018893625.1.52668 WP_018893625.1.71458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]