SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C5KSN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1C5KSN5
Domain Number - Region: 18-101
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0085
Family Pseudo ankyrin repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C5KSN5
Sequence length 113
Comment (tr|A0A1C5KSN5|A0A1C5KSN5_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:SCG91053.1} OX=765821 OS=uncultured Blautia sp. GN=SAMEA3545287_00256 OC=Blautia; environmental samples.
Sequence
MSKRTRIHPVQFYLNDDEQYILEEKYRLSRMKSKSAFLRKMILYGFVYEVDYSHIRKMNT
LLGNISSNLNQITHRINSSNTVYQKDLDDIKELMEKIWQLQKSMVSKQPLIKQ
Download sequence
Identical sequences A0A173WE89 A0A174EC02 A0A1C5KSN5 C6J8F9
WP_008703806.1.3573 WP_008703806.1.37309 WP_008703806.1.61664 WP_008703806.1.92233 WP_008703806.1.92979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]