SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C5WAU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C5WAU6
Domain Number 1 Region: 36-120
Classification Level Classification E-value
Superfamily TrpR-like 6.28e-20
Family SPO1678-like 0.068
Further Details:      
 
Weak hits

Sequence:  A0A1C5WAU6
Domain Number - Region: 139-167
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0209
Family Delta-sleep-inducing peptide immunoreactive peptide 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1C5WAU6
Sequence length 192
Comment (tr|A0A1C5WAU6|A0A1C5WAU6_9CLOT) Transposase {ECO:0000313|EMBL:SCI19902.1} OX=59620 OS=uncultured Clostridium sp. GN=SAMEA3545261_02425 OC=Clostridium; environmental samples.
Sequence
MAKYSYEFKKKVVQEYLDGKGGYAYIAKQNGIPAESLLRRWVNAYKKFGDEGLLRSRKNK
NYSFQFKLFVVELYLTSEVSYQELALSQGINNPSLLVKWVNDFRISGTEALRPKKKGRKK
TLDIKEFKKPSNPIEVKSVDTSAEHVKELEDELLKLRIENAYLKELRRLRLEEETLLKKQ
RESSTVSEDSST
Download sequence
Identical sequences A0A1C5WAU6 R6N187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]