SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C6BVR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C6BVR6
Domain Number 1 Region: 215-278
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000265
Family Type I dockerin domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C6BVR6
Sequence length 284
Comment (tr|A0A1C6BVR6|A0A1C6BVR6_9FIRM) Dockerin type I repeat {ECO:0000313|EMBL:SCI88101.1} OX=165186 OS=uncultured Ruminococcus sp. GN=SAMEA3545397_01403 OC=Ruminococcus; environmental samples.
Sequence
MNIGKRFLNVLLSVVLILYSLFSVQLISVSAEEKSNAKESNLTEAVLPELITSISKSVSN
TYILLGSKAIYKEAKVGNVTVKCGEKVVVPLELDSINNSATVVVSLPEGVTCEKVVDNLG
NPLKTVNNNSTSEFTMTDTKAFITYSVDKNLTDGEYNIKYNIIGNYYSEIYEVFGGGFTV
TGNFAETTPTVTTYTETKTTTTVTSVNELPVVPIKPVKGDANGDGKLRASDAAFIAKTLA
EASIAGKKINLEDYPNADFNEDGKITAADAAAIAKYLAEQSIKK
Download sequence
Identical sequences A0A1C6BVR6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]