SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C6ETS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C6ETS8
Domain Number 1 Region: 6-131
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 2.88e-25
Family Thiamin pyrophosphokinase, catalytic domain 0.0045
Further Details:      
 
Domain Number 2 Region: 150-208
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.0000000222
Family Thiamin pyrophosphokinase, substrate-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C6ETS8
Sequence length 214
Comment (tr|A0A1C6ETS8|A0A1C6ETS8_9CLOT) Thiamine pyrophosphokinase {ECO:0000313|EMBL:SCJ24173.1} OX=59620 OS=uncultured Clostridium sp. GN=SAMEA3545404_01160 OC=Clostridium; environmental samples.
Sequence
MRAFDCLIVLGGARPPLEQLRGLAQAARWVIAADKGAEYLLEAQVPIDYLVGDMDSLPPE
RLQDPALAHTKVKRYPTHKDDTDAMIAAELALALGAGSIVFAAALGTRLDHMLGNIQILY
KLHRDGVRAQIVQGRARAFVGSGCFTIDGEVGDTVSLFPLGRAHIADTSGLEYPVMDADL
PVDRPLGVSNVLTEPQAAVTVENGYVLAVVPGVD
Download sequence
Identical sequences A0A1C6ETS8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]