SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C6Q119 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C6Q119
Domain Number 1 Region: 129-218
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase II 2.79e-18
Family Peptidyl-tRNA hydrolase II 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C6Q119
Sequence length 221
Comment (tr|A0A1C6Q119|A0A1C6Q119_9ACTN) Peptidyl-tRNA hydrolase {ECO:0000313|EMBL:SCK49189.1} KW=Complete proteome OX=1286821 OS=Streptomyces sp. WMMB 322. GN=H180DRAFT_04418 OC=Streptomyces.
Sequence
MNDAQEYALPLVVRVEREAPPERTDALETAARAVLTFLSDERAAEDGEWGERVRAWEDSA
IRKVVRRARGADWRRAEALPGVTVTGRTAAVRVCPPVPVDDWPRDLARLQVSGTELTDPE
PPAAPPPGVPVMWLAPDLEMSAGKAMAQAGHGAQLAWWELSAAARTDWREAGFDLAVRRA
AGPGQWAPLVRGGLPLVRDAGFTEVAAGSVTVVAGHPALQT
Download sequence
Identical sequences A0A1C6Q119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]