SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C6SND6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C6SND6
Domain Number 1 Region: 7-141
Classification Level Classification E-value
Superfamily LigT-like 0.0000000000209
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C6SND6
Sequence length 171
Comment (tr|A0A1C6SND6|A0A1C6SND6_9ACTN) 2'-5' RNA ligase superfamily protein {ECO:0000313|EMBL:SCL30968.1} KW=Complete proteome OX=47866 OS=Micromonospora inyonensis. GN=GA0074694_5848 OC=Micromonospora.
Sequence
MVAALELYLDTDAARRIRVLWEALEAEGVQSLRYLLDQRHRPHVSLAVAPRLDPERVVGA
LAGMTVAAPLRMSFLHAGQFVGRVLWLGPTPTAELLAHHAEVHARLTRAGVGLSEHYQPD
RWVPHCTLSMRVPNALMAAAVRRCLEVLPIEARVVGAAVTDHARGIAHPLS
Download sequence
Identical sequences A0A1C6SND6
WP_091463013.1.54322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]