SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C6WQY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C6WQY3
Domain Number 1 Region: 415-516,664-712
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000533
Family Nucleotide and nucleoside kinases 0.033
Further Details:      
 
Domain Number 2 Region: 188-300
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000394
Family Tyrosine-dependent oxidoreductases 0.02
Further Details:      
 
Weak hits

Sequence:  A0A1C6WQY3
Domain Number - Region: 846-875
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0706
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1C6WQY3
Sequence length 904
Comment (tr|A0A1C6WQY3|A0A1C6WQY3_PLABE) p-loop containing nucleoside triphosphate hydrolase, putative {ECO:0000313|EMBL:SCL91634.1} KW=Complete proteome OX=5821 OS=Plasmodium berghei. GN=PBNK65E_000052000 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MKIFINNINTYSGSCLCETLDIIQNEKCEIYGTLINQNEAKEEDMYMYNYNNVKKIVSKT
NKDKLVKYIVTSNLCVFDMHNTGIEEIEYVIRKLKNEEIKTKVTFILVSSIMTWNKTKRK
FVKKKIEEKIEEKIEQSDNVLTKQTNDKINSVQNCQKNNIDKYRYIPEAFSEKDYLKRIP
SSGFKELKTIEILVLSLNSIKNINTYVVASGILYGNGENVFFPIFKNAWFGKDNQIIDKG
NNFIPVIHVKGLCEYVKNVFIYKPEIKYLIAVDQEYVTQKDIIKSVANYISANNNYLSVS
SYDSIFIKDSEKLCINLRFQCTRFWNLNQVDAINEKKKDNPNVLSSDNEESGQIGENSES
EENSENEKNSENKENSENGKRGEEESCIKFHCQDGFVKNISILTKEFCEYRNLKSLKIMI
MGPPGVGKTFIGKKICEHYNLKICSIQTLLDECKKTNYKFPEYYTNNLNDVGNTNKLNLN
DISSIFYKKLKSNECKFRGYVLDSFPRNYYEAKMFFEKYFVSDVVDSSKDLTYSKNETMK
KKHKKIKNKNEKRRNSNESKHSEESEMSLSEEETESKVDDESEEDEHSDSINKKTSSQSY
TSESLDELENEDQTSENGDSSNEDRINENTKKNKKYDIKNDSEENKNNEYIYNENKNMDP
RNNPILPEFVIILKSKEDLCRIRMMNLPKDEIIKGHNDEKGFERRYNKYIEENCRNDYLE
FDKKNTIEDYFIENQIEVLNININEKSILEDILTNIYIYIEKNKKFYNFLPSTDEILKNK
LHEQEIKLLNEKENIKKNEDNTINEELNKNDELIKAEKKRQQLLMEYQQQYIHNQSLPLR
FYLIKNILPILTDALIYICKTKPKNPCLHIAEYLLENAHKYNVDENTLPLIPPKKNEDKD
SPNN
Download sequence
Identical sequences A0A077X6Z2 A0A1C6WQY3
PBANKA_040430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]