SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C7NLQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C7NLQ7
Domain Number 1 Region: 4-271
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.15e-88
Family Capz alpha-1 subunit 0.000000721
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1C7NLQ7
Sequence length 277
Comment (tr|A0A1C7NLQ7|A0A1C7NLQ7_9FUNG) F-actin-capping protein subunit alpha-1 {ECO:0000313|EMBL:OBZ89386.1} KW=Complete proteome; Reference proteome OX=101091 OS=Choanephora cucurbitarum. GN=A0J61_02562 OC=Choanephoraceae; Choanephoroideae; Choanephora.
Sequence
MTTVSIEDKVKIASDFLLSSPPGEVNDVFNDVRMLVDDDESLQEGILQALVRYNTEQHVT
VRPPGLEYDVVLSKYGKIEQDRFLDPRSKKTFKVDHMRLTASDLEDDTTETAFENLRSNV
EKECITYIEDHFPNGICSVYIHESEIAIAIVDNKYNPNNFWNGRWLASWVYDTQSGNLKG
TTKVNVHYYEDGNVQLKADKEASLHVDMKDDYEQLAKEIAKEIAGFDKQYQSSMNDSYSE
LSENTFKGLRRALPMTRNKMDWNKILNYKIGSELAQK
Download sequence
Identical sequences A0A1C7NLQ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]