SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C7NM44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C7NM44
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 5.36e-29
Family Tubulin chaperone cofactor A 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1C7NM44
Sequence length 105
Comment (tr|A0A1C7NM44|A0A1C7NM44_9FUNG) Tubulin-specific chaperone A {ECO:0000256|RuleBase:RU364030} KW=Complete proteome; Reference proteome OX=101091 OS=Choanephora cucurbitarum. GN=A0J61_01798 OC=Choanephoraceae; Choanephoroideae; Choanephora.
Sequence
MPLSQLKIKTNVVKRIYKEHLGYAKEAEMQQSRIDKLIAEGADEADVKKQREVLAETHQM
IPDVKKRLTNAYQDLQNQLENSESADLDELQEAQTVIADIGAHTF
Download sequence
Identical sequences A0A1C7NM44

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]