SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C8FVK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C8FVK7
Domain Number 1 Region: 203-319
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.14e-36
Family eIF-2-alpha, C-terminal domain 0.0000636
Further Details:      
 
Domain Number 2 Region: 94-199
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 2.62e-29
Family eIF2alpha middle domain-like 0.0002
Further Details:      
 
Domain Number 3 Region: 15-97
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.04e-16
Family Cold shock DNA-binding domain-like 0.0000798
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C8FVK7
Sequence length 343
Comment (tr|A0A1C8FVK7|A0A1C8FVK7_TOBAC) eukaryotic translation initiation factor 2 subunit alpha-like {ECO:0000313|RefSeq:XP_016475076.1} KW=Complete proteome; Reference proteome OX=4097 OS=Nicotiana tabacum (Common tobacco). GN=LOC107796781 OC=Nicotianoideae; Nicotianeae; Nicotiana.
Sequence
MATNSPNLECRMYEAKYPEVDMAVMIQVKSMADSGAYVSLLEYNNIEGMILFSELSRRRI
RSISSLIKVGRIEPVMVLRVDKEKGYIDLSKRRVSEEDISACEERYNKSKLVHSIMRHVA
ETMGIDLEDLYIHVGWPLYRKYGHAFEAFKLVVSDPDSILNSLTREVKEIGPDGKEVTKV
APALSEEVKDALVKNIRRRMTPQPLKIRADIEMKCFQFDGVLHIKEAMRKAEAAGNDDCP
VKIKLVAPPAYVLNTQTLDKEQGIAILTKAIAACTEEIERHKGKLAVKEAPRAVSEREDK
LLAEQMAKLGRENEEISGDEDSEEEEDTGMGEIDVDSGAGIRE
Download sequence
Identical sequences A0A1C8FVK7 A0A1U7VFH0
XP_009765108.1.57364 XP_016475076.1.3737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]