SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C9EFP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C9EFP8
Domain Number 1 Region: 15-43
Classification Level Classification E-value
Superfamily Defensin-like 0.0000299
Family Defensin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1C9EFP8
Sequence length 44
Comment (tr|A0A1C9EFP8|A0A1C9EFP8_TACBI) Avian beta defensin 2 {ECO:0000313|EMBL:AON96314.1} OX=72873 OS=Tachycineta bicolor (Tree swallow). GN=BD2 OC=Tachycineta.
Sequence
FIAGLSSPQREMLFCRGGSCHFGGCPFHLVKVGSCFGFRSCCKS
Download sequence
Identical sequences A0A1C9EFP8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]