SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C9HH99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1C9HH99
Domain Number - Region: 1-51
Classification Level Classification E-value
Superfamily RNA polymerase subunit RPB10 0.00275
Family RNA polymerase subunit RPB10 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C9HH99
Sequence length 63
Comment (tr|A0A1C9HH99|A0A1C9HH99_LSDV) RNA polymerase subunit {ECO:0000313|EMBL:AOO78615.1} OX=59509 OS=Lumpy skin disease virus (LSDV). GN=LD055 OC=Capripoxvirus. OH=9913
Sequence
MVFQLVCSTCGRDISEERYALLIKEVNIKKVLSRVKNSCCRLKLSTQIEPQRNLTVQPLL
DIN
Download sequence
Identical sequences A0A075CL64 A0A1B2LPM3 A0A1C9HH99 A0A2H4EUH9 Q77GD6
NP_150489.1.30698 NP_659627.1.31432 YP_001293246.1.73484 Q77GD6_LSDV Q77GM9_LSDV Q91MV2_LSDV gi|148912932|ref|YP_001293246.1| gi|15150494|ref|NP_150489.1| gi|21492508|ref|NP_659627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]