SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C9I4L6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C9I4L6
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 3.92e-33
Family CobE/GbiG C-terminal domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C9I4L6
Sequence length 127
Comment (tr|A0A1C9I4L6|A0A1C9I4L6_RHILT) Precorrin methylase {ECO:0000313|EMBL:AOO93924.1} OX=386 OS=Rhizobium leguminosarum bv. trifolii. GN= OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MLGLGCERGTSPAEVLALAIEALDVAGIGAAELATIASIDSRRLEPAILAVAAHFSVPGV
FFDALRLEEETPRLANPSAVVFARVGCHGVAEAAALAAAGPDAELAVAKMKSAHATAAVA
RSGLQKA
Download sequence
Identical sequences A0A1C9I4L6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]