SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C9LY90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1C9LY90
Domain Number - Region: 35-120
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0994
Family PspA lactotransferrin-binding region 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1C9LY90
Sequence length 185
Comment (tr|A0A1C9LY90|A0A1C9LY90_9CAUD) Scaffolding protein {ECO:0000313|EMBL:AOQ27850.1} KW=Complete proteome OX=1897543 OS=Mycobacterium phage Pomar16. GN=SEA_POMAR16_18 OC=Viruses; dsDNA viruses, no RNA stage; Caudovirales; Siphoviridae.
Sequence
MGSSTMPRRRKHMSDTATTEGTPAGDPTPVVTDKPLEPTPKTYDEAYVKELRQEAAAARV
AKKDAVEAAVKAANDAHTAELAARDTRITELENELGQAWIRLQKLETSLAAKVPSDKVLA
FVDILQGEDADSIAESAKKNLELIGGFDKKPVSGFDPTQGFGGRQELPLNGDPILNAMKG
VLGIK
Download sequence
Identical sequences A0A1C9LY90 A0A1J0GVD1 O64209
gi|9630399|ref|NP_046831.1| NP_046831.1.18220 VG16_BPMD2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]