SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C9U4K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C9U4K9
Domain Number 1 Region: 6-180
Classification Level Classification E-value
Superfamily YfbU-like 4.71e-21
Family YfbU-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C9U4K9
Sequence length 183
Comment (tr|A0A1C9U4K9|A0A1C9U4K9_9BACT) Uncharacterized protein {ECO:0000313|EMBL:AOR51082.1} OX=1781154 OS=uncultured bacterium pAP3. GN= OC=Bacteria; environmental samples.
Sequence
MTGRTVHLSAGDKLNFMLLRDIAKHLKVPTETDVDLMAEVIYGGHYWAPAWEMQGLFHNH
ADRPADVSLVVNVLDMWSFIEERVEKLEPSDLEKVKAANYGHVPEFAGFDGNNESELMNI
AHFLVEKMNRFSRFKGRDFNSHSLSIARQRRMVAAFEPIRATLDLGRQLTASQIIAILEA
GRA
Download sequence
Identical sequences A0A1C9U4K9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]