SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D1USY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D1USY8
Domain Number 1 Region: 190-253
Classification Level Classification E-value
Superfamily XPC-binding domain 1.7e-18
Family XPC-binding domain 0.00037
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.91e-17
Family Ubiquitin-related 0.0006
Further Details:      
 
Domain Number 3 Region: 114-173
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000993
Family UBA domain 0.0039
Further Details:      
 
Domain Number 4 Region: 281-336
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000121
Family UBA domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D1USY8
Sequence length 340
Comment (tr|A0A1D1USY8|A0A1D1USY8_RAMVA) Uncharacterized protein {ECO:0000313|EMBL:GAU90347.1} KW=Complete proteome; Reference proteome OX=947166 OS=Ramazzottius varieornatus (Water bear) (Tardigrade). GN=RvY_02775 OC=Hypsibiidae; Ramazzottius.
Sequence
MKVSCRLLSQEKFEIEAEPSTTVEQFKAKIEEKKGKSFQADTLKLIYAGRVWDNNTSTLA
EMNFSDSGFVVVMVNKPKAVPKTEPSTSAQTSSPIVTNIQPEQVPRPHAPSPAQQARSSV
RPEAAFGLSPEEYESIVQNIVGMGYPRLDVERALRASFFNAERAVEYLLTGIPAEPGSLG
SDQGEEGQGDRDALSFFRNSPQFREMRAMIQQDPSLLSRMLQDIGQSNPRLFQAIRDHQA
EFIGMMNAPLPAESATPAAPSASPSAAVGGAAGTAQRPVAAGGVAAPAMRLSPEDREAVE
RLKSLGFLEAAVIEAYFACDKNEQHAANFLFAQMEEEGIG
Download sequence
Identical sequences A0A1D1USY8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]