SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D1W5P3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D1W5P3
Domain Number 1 Region: 77-189
Classification Level Classification E-value
Superfamily GINS helical bundle-like 3.09e-18
Family PSF3 C-terminal domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily PriA/YqbF domain 4.58e-17
Family PSF3 N-terminal domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D1W5P3
Sequence length 222
Comment (tr|A0A1D1W5P3|A0A1D1W5P3_RAMVA) Uncharacterized protein {ECO:0000313|EMBL:GAV08606.1} KW=Complete proteome; Reference proteome OX=947166 OS=Ramazzottius varieornatus (Water bear) (Tardigrade). GN=RvY_18271 OC=Hypsibiidae; Ramazzottius.
Sequence
MKEFYLATTHETYLSLSDIMVTDEKVACTVTVDFAGLGYIHPSSSSEAGDLTVGTTLDLP
LWMATLMYRRQYATIQIPPAYQEEARKILNVDPAVVDLRKECAGRFRWRFSENYYALGLY
IIPFSLNDAKEIRRSLTSTFQHRFRKIMDWSNSTHRDTLTNLYNRLDRSEVQLLQMGKAE
QTALSDWLDRRTKFLKASHLVKSAQSTRAQPQRTDSRKRARF
Download sequence
Identical sequences A0A1D1W5P3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]