SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D1ZYX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D1ZYX5
Domain Number 1 Region: 38-115
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 1.57e-18
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0011
Further Details:      
 
Domain Number 2 Region: 116-195
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000036
Family Cold shock DNA-binding domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D1ZYX5
Sequence length 251
Comment (tr|A0A1D1ZYX5|A0A1D1ZYX5_AUXPR) Uncharacterized protein {ECO:0000313|EMBL:JAT71883.1} OX=3075 OS=protothecoides). GN=g.1590 OC=Chlorellaceae; Auxenochlorella.
Sequence
GYTFYHTSQIIGFECTISSALALASRAPHGHETGPPPMFVLCTLEDKVRLAPKDLRLDTA
DAVTAVLEKTYLDRVIPDLGLVVTLYDLLDIGDGYVFQSDGGVHHDTTFRVVAFRPSQEE
VLVGEVISQDERTGVHVGLGFFEDIIIPPYGMPEPHSWDPEEKAWSWDLEGEEGASQLYF
ETGLPVRLQVTGLTYTPPPTPVDQSAAQSRGDPIPGSADCPHAPLVVTAKADGDGLGMVH
WYDEGAMEEGS
Download sequence
Identical sequences A0A1D1ZYX5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]