SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D2M7A5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D2M7A5
Domain Number 1 Region: 160-522
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-68
Family Ankyrin repeat 0.00000945
Further Details:      
 
Domain Number 2 Region: 541-894
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.3e-63
Family Ankyrin repeat 0.00000723
Further Details:      
 
Domain Number 3 Region: 868-1074
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.93e-43
Family Ankyrin repeat 0.00016
Further Details:      
 
Domain Number 4 Region: 55-186
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.86e-21
Family Ankyrin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 1056-1182
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000497
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D2M7A5
Sequence length 1690
Comment (tr|A0A1D2M7A5|A0A1D2M7A5_ORCCI) Ankyrin-3 {ECO:0000313|EMBL:ODM88846.1} KW=Complete proteome; Reference proteome OX=48709 OS=Orchesella cincta (Springtail). GN=Ocin01_17836 OC=Orchesella.
Sequence
MKEEEVRDTAAGMRLLQLCQSKDWYGVDGHLRYLEKRVETGITSNKTPLSGVKDEGNGWT
PLMYAIRDNALIMAERLIAMGCNINEEAKDGGLSCMHMAVYHGRDDTVRYLISKKANVNV
VTKDKQQNLLHVACARPAGNSASILRALLAAMPKDSRLKQDKEGNIPLFIALKHGNLGAC
QELLAYQGKEQLEMRSGPEEDTPLHTAVKKKDLEICRIFVDAGANVDAVNKDGQTPLHIA
STLGEENMVKFLFLCKANPHLVDKEDRTALHVAAMSGQTQLIDLLTDKFKVSVFERTRDG
STLMHIASLHGHPETAMALFRKGVPLQMPNKGGARSIHISARHGHSGMISKLLEKGENVD
SKTNDNFTALHIAVEAVKPAVVECLLGYGAQVHIKGGKSQETPLHIAARVVGGETCALML
LKSGTNPNVTMDNGETPMHVAARHGRLKIIRLLLQDGANPQLKARDGDTPLHFACRYGHI
FVVEALLEHVKKKSANECSLFINMVTMKGETALHYAARLNPAKIRLEESEEDLNKDEIGK
NIVKMLLDGGASTSRQAKETNETAFHYCAKEGNNPILLEMLGRLTSVECQRALNRQSSKG
WSPLLIASRRGHSQCVETLLEYHARVDVFDTDGRSGLHLAAENGYQEICGILLEHRAFIN
AKSRVGLTALHLAATKGFTRLCLFLIQTHGAAVDALTLKKQTPLHLAAESGQLEVCRLLM
GLRASPDATDDKGQKPIHLAAQNNHADVIKLFLKHSSALVNSFTKDGSTCAHLAAMQGSV
AVLEELMKFDKQGVINARNRSTDATALQLAAEGGHADLVNSLLQAGASASDENRLGYTAA
HLAAKNGHSNVLEALRNAQEDSINITSRKLGTSALHIAAYYGQTETVRELLQYIPATSTT
DPPFSPATAFIREIGTESGLTPLHMAAFAGEENVVRLLLNFEGVQVDAGTTIYGFNSLHL
ACWGGHSTVVGLLLSRSSELLESKDASGKSSLHIAAINGHKSMVEVLLGQGAEIDAIDKE
LWTPLICAAQAGHLDVVRLLVESGASPLAKNVKGHSAIWFAAAENHNDVLSYLMRKDHDT
YGLLEDKEFVYNLCVCGKNIDNEPIDEFVLSSPAPVEVAAKMSSFLVYVSTKEKERAKDL
IAASKHCEEMATELLALAAGAESAGKVLKSVDRKGKEFLDVLIENEQKETVAHTVVQRHL
QEIWVGQLVEWADYKHMLLFLSMVFCPPVWVTFSVPFGPQYNKIPIVKFMSYLTSHIHLM
ILLCLTCVTPIHPVFPIRSNLVPFWFEWMLMAWLTGLLVAEITNPSDKSGLGWIKTVVLT
FCYLGIMLHAVAFFIDKENYGTILYLRDQLLGVGILSACIQILDFLSFHYLFGPWAIIIG
NLMKDLARFLAVLMIFMIGFSLVMAALNHPLHPRRGLLPGEKVPPTLTGGMASGVLVTPL
DAFELLFFGLFGENGPTDMRIEILGQPDWTIVLFKIVFGVYLLVTVIVLINLLIAMMSDT
YQRIEAQSDIEWKYGLAKLIRSMHRTTATPSPLNLFVDWGTWIHKKIKKAREPKKKLSWE
HGGDEFEAEQQALKVTKIDPKVRWQQALKKLELNKASGNVLQLSATQIAQIAGSLTASGL
GSRFSGGGGVLNRIETVTDWLVIAKKYRMLVGKDEPPKDADEGGDRGSRRSSSHMGSSMM
LVSAQALNVT
Download sequence
Identical sequences A0A1D2M7A5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]