SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D2NIG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D2NIG6
Domain Number 1 Region: 2-57
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 4.45e-22
Family Nucleolar RNA-binding protein Nop10-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D2NIG6
Sequence length 64
Comment (tr|A0A1D2NIG6|A0A1D2NIG6_ORCCI) H/ACA ribonucleoprotein complex subunit 3 {ECO:0000313|EMBL:ODN05064.1} KW=Complete proteome; Reference proteome OX=48709 OS=Orchesella cincta (Springtail). GN=Ocin01_01620 OC=Orchesella.
Sequence
MHLMFYLDKNGDRVYTLKKEDPKGNPTISAHPARFSPEDQYSRERIIIKKRFGLLLSQKP
KIAV
Download sequence
Identical sequences A0A1D2NIG6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]