SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D2WAV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1D2WAV0
Domain Number - Region: 41-75
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.0706
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D2WAV0
Sequence length 106
Comment (tr|A0A1D2WAV0|A0A1D2WAV0_9EURY) Uncharacterized protein {ECO:0000313|EMBL:OEC87370.1} KW=Complete proteome OX=1860157 OS=Methanosphaera sp. A6. GN=A9758_04225 OC=Methanobacteriaceae; Methanosphaera.
Sequence
MVKDLWPYPNEKYLHEIEDELYEYAVAHPEEYIGLNLSLDSTDEFLNKLTELYSEGEYHK
TYMKILDKVKRADMDYEYWKTPIEIAEWFVKKHPQWKELYYYDDEE
Download sequence
Identical sequences A0A1D2WAV0 Q2NG23
339860.Msp_0841 WP_011406429.1.14142 WP_011406429.1.32456 gi|84489641|ref|YP_447873.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]