SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D2X580 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D2X580
Domain Number 1 Region: 36-124,166-179
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000615
Family Pseudo ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D2X580
Sequence length 189
Comment (tr|A0A1D2X580|A0A1D2X580_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:OED40291.1} KW=Complete proteome; Reference proteome OX=1868284 OS=Endozoicomonas sp. (ex Bugula neritina AB1). GN=ACH42_17440 OC=Endozoicomonaceae; Endozoicomonas.
Sequence
MDKKQLVQLFDNLDINKEENVLDKALKVAVYESVEQKLIINDVSGSYLAWLAINAVIKGN
LEVLRNLAAQYTELFVQEVNEGGRTHSLREVLFIEAARQGRIEVFEYLKEEIQNEHSELL
SASIIYRGVRATVVAMALCTAADNISDYIGAEKGEEDFVQRPFQREQGRLTIFKYLLEYD
SYILSRHHY
Download sequence
Identical sequences A0A1D2X580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]