SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D3NCG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D3NCG4
Domain Number 1 Region: 9-40
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.000034
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D3NCG4
Sequence length 75
Comment (tr|A0A1D3NCG4|A0A1D3NCG4_BACMY) Uncharacterized protein {ECO:0000313|EMBL:SCM95967.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=BLX04_21920 OC=Bacillus cereus group.
Sequence
MNLEKSKPVNEEVAELKELIKELHGSVHQLQSEVQQLRHERPVVEVRKGVQLSPTIVGQI
GGMILGGLAIIGIFW
Download sequence
Identical sequences A0A1C6XF29 A0A1D3NCG4 A0A1H4FV82 A0A2A8UR26 A0A2B8UTS7 A0A2H3N3I2 C2PP78 C2PYM4 C2QEM4 J8B2M3 J8IE52 J8QW53 R8HJU1 R8P242
WP_001047525.1.100621 WP_001047525.1.11609 WP_001047525.1.17265 WP_001047525.1.28299 WP_001047525.1.35026 WP_001047525.1.37019 WP_001047525.1.51556 WP_001047525.1.58335 WP_001047525.1.6 WP_001047525.1.60781 WP_001047525.1.61126 WP_001047525.1.68550 WP_001047525.1.72294 WP_001047525.1.79293 WP_001047525.1.83938 WP_001047525.1.93582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]