SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5PCI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5PCI4
Domain Number 1 Region: 160-281
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.75e-34
Family cAMP-binding domain 0.000000903
Further Details:      
 
Domain Number 2 Region: 289-413
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.81e-32
Family cAMP-binding domain 0.000000777
Further Details:      
 
Domain Number 3 Region: 56-103
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 3.14e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D5PCI4
Sequence length 422
Comment (tr|A0A1D5PCI4|A0A1D5PCI4_CHICK) Protein kinase cAMP-dependent type I regulatory subunit beta {ECO:0000313|Ensembl:ENSGALP00000050473} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=PRKAR1B OC=Phasianidae; Phasianinae; Gallus.
Sequence
MLRLRSPPPLFYKLFIAGTESPDSSTWLISATVCLLFTSLKMAAASSCSVEEDESLKGCE
LYVQKHNIQQILKECIVNLCIAKPDRPMKFLREHFEKLEKEECKQILARQKSSSQSDSHD
DEISPPPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFA
HLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQGEVDVYVNGEWVTSIGEGGS
FGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESL
DKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGTASVLQRRSDNEEYVEVGRLG
PSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISL
TV
Download sequence
Identical sequences A0A1D5PCI4
XP_004945171.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]