SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5Q4H6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5Q4H6
Domain Number 1 Region: 64-255
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.17e-69
Family Glutathione peroxidase-like 0.0000000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D5Q4H6
Sequence length 256
Comment (tr|A0A1D5Q4H6|A0A1D5Q4H6_MACMU) Thioredoxin-dependent peroxide reductase, mitochondrial isoform a {ECO:0000313|EMBL:AFJ70637.1} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=PRDX3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAAAVGRLLRASVTRHVSAIPWGISATAALRPAACRRTSLTNLLCSGSSQAKLFSTSSSY
HAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKAN
EFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGPG
LALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPADWTPDSPTI
KPNPAASKEYFQKVNQ
Download sequence
Identical sequences A0A1D5Q4H6
ENSMMUP00000010873 NP_001252755.1.72884 9544.ENSMMUP00000010873 ENSMMUP00000010873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]