SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5QNP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5QNP5
Domain Number 1 Region: 11-50
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 7.98e-17
Family Nucleolar RNA-binding protein Nop10-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D5QNP5
Sequence length 56
Comment (tr|A0A1D5QNP5|A0A1D5QNP5_MACMU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMMUP00000049671} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
LFVQLFELIIKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL
Download sequence
Identical sequences A0A1D5QNP5 A0A2K5KC60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]