SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5S730 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5S730
Domain Number 1 Region: 9-113
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 4.84e-34
Family Thiamin pyrophosphokinase, catalytic domain 0.00043
Further Details:      
 
Domain Number 2 Region: 113-195
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 2.88e-27
Family Thiamin pyrophosphokinase, substrate-binding domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D5S730
Sequence length 195
Comment (tr|A0A1D5S730|A0A1D5S730_WHEAT) Uncharacterized protein {ECO:0000313|EnsemblPlants:TRIAE_CS42_1BL_TGACv1_030471_AA0091910.2} KW=Complete proteome; Reference proteome OX=4565 OS=Triticum aestivum (Wheat). GN=4338566 OC=Pooideae; Triticodae; Triticeae; Triticinae; Triticum.
Sequence
MPELLPGHDPDDVRSRYKPDVIKGDMDSVRPEVKEYYSNLGTKIADQSHDQDTTDLHKCV
AFITDNSPGSDKSNLCILVLGALGGRFDHEMGNINVLHLFPNIKIVLLSDDCLIFLLPRT
HTHNIHIERSVEGPHCGLIPVGAPSTSTTTTGLRWNLDNTHMSFGGLISTSNIVDEDQVM
VTSDSDLIWTISLRH
Download sequence
Identical sequences A0A1D5S730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]