SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5TQV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5TQV0
Domain Number 1 Region: 33-185
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 1.08e-54
Family Pollen allergen PHL P 1 N-terminal domain 0.021
Further Details:      
 
Domain Number 2 Region: 164-255
Classification Level Classification E-value
Superfamily PHL pollen allergen 2.88e-33
Family PHL pollen allergen 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D5TQV0
Sequence length 261
Comment (tr|A0A1D5TQV0|A0A1D5TQV0_WHEAT) Uncharacterized protein {ECO:0000313|EnsemblPlants:TRIAE_CS42_2AS_TGACv1_114363_AA0366370.1} KW=Complete proteome; Reference proteome OX=4565 OS=Triticum aestivum (Wheat). GN=4335222 OC=Pooideae; Triticodae; Triticeae; Triticinae; Triticum.
Sequence
MGTSAGSSLRLFVLFAVATCLLWSTASGFSASGVSRAFATFYGGSDASGTMGGACGYGNL
YSTGYGTNTAALSTALFNDGASCGQCYRIRCDYAADPRFCIRGASVTITATNLCPPNYAL
PNDDGGWCNPPRQHFDMAEPAWLNIGVYRGGIVPVLYQRVPCAKKGGVRFTVNGHDYFEL
VLVSNVGGVGSIRSVSIKGSRTGWMPMSRNWGVNWQSNALLTGQSLSFQVTSTDGQTLTF
PNAAPAGWGFGQTFATNKQFS
Download sequence
Identical sequences A0A1D5TQV0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]