SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D6LRB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D6LRB7
Domain Number 1 Region: 114-169,221-293
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000379
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D6LRB7
Sequence length 312
Comment (tr|A0A1D6LRB7|A0A1D6LRB7_MAIZE) Putative ribosomal protein S4 (RPS4A) family protein {ECO:0000313|EMBL:AQK82002.1} KW=Complete proteome; Reference proteome OX=4577 OS=Zea mays (Maize). GN=ZEAMMB73_Zm00001d036814 OC=Zea.
Sequence
MLVALVSGSEPAPIHSFSSSLGGSGFEYPFHSHIQIHGIVDWTHRGTVLTLPSPGSLPVT
SRSDSSSANEVGHNLLDPSAFLSSFVSKGRKKIVKQGSFNTFYAKEYRATLEFYWAPFLV
ESNSNNPNFHNIKERIISPERIEAHAKHWKDVDYLIFNTYIWWMNNADIKVGSTPTSHPL
TGNVRPNLRYWSNNDEVPRIEAYDCVFKTWSDWLNDNIDPTRTSVFMTISPRNLSGNLPI
LRFLLDHGDDLHEEGSLEGKSMVLIWHVVFSGNLPILRFLLDHGDDLHEEGSLEGHDRFT
ILHTTTKKDIIV
Download sequence
Identical sequences A0A1D6LRB7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]