SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D6Q8W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D6Q8W5
Domain Number 1 Region: 76-218
Classification Level Classification E-value
Superfamily RuBisCo LSMT C-terminal, substrate-binding domain 9.55e-23
Family RuBisCo LSMT C-terminal, substrate-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D6Q8W5
Sequence length 253
Comment (tr|A0A1D6Q8W5|A0A1D6Q8W5_MAIZE) Rubisco methyltransferase family protein {ECO:0000313|EMBL:AQK54832.1} KW=Complete proteome; Reference proteome OX=4577 OS=Zea mays (Maize). GN=ZEAMMB73_Zm00001d051669 OC=Zea.
Sequence
MRRLFHMLRRLPGSEKPSSRLSASKWEAKREHFPVRARPEVFISYGKKSSGELLLSYGFV
PKEGTNPNDSVELLVSLDKSDNCYKEKLQALKRNGLSESESFPLRVTGWPVELMAYAFLV
VSPPDMSQCFEEMAAAASNKTSSKPGLNYPDLEEQALQFILDCCESNIEKYTKYLEGGAG
SPEVPMNAKQANRTLLLKQLARDLCISERRILYRTQYVSQCFDLAAKASDTCMPNQTAVQ
ALGRKFHLDARNK
Download sequence
Identical sequences A0A1D6Q8W5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]