SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D7TWR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D7TWR4
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily RPA2825-like 4.45e-44
Family RPA2825-like 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D7TWR4
Sequence length 120
Comment (tr|A0A1D7TWR4|A0A1D7TWR4_9BRAD) Uncharacterized protein {ECO:0000313|EMBL:AOO79561.1} KW=Complete proteome OX=1526658 OS=Bosea vaviloviae. GN=BHK69_02835 OC=Bradyrhizobiaceae; Bosea.
Sequence
MGIFDSIKKAIFGEAKAGTAGGASTASVGSATATQQVDVAPILDKAVKDTGQNLAWKTSI
VDLLKALKIDSSLTARKELAHELGYTGSTDDSATMNVWLHKAVIKKLSENGGKVPADLLD
Download sequence
Identical sequences A0A1D7TWR4
WP_069688783.1.93298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]