SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D7W3K4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D7W3K4
Domain Number 1 Region: 13-93
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 0.00000000000000262
Family PG0164-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D7W3K4
Sequence length 185
Comment (tr|A0A1D7W3K4|A0A1D7W3K4_BRELN) Uncharacterized protein {ECO:0000313|EMBL:AOP53540.1} KW=Complete proteome OX=1703 OS=Brevibacterium linens. GN=BLSMQ_1830 OC=Brevibacterium.
Sequence
MTMSTKTNTPTAIEFSATLEVINERTILRLPAEASAELPSRGQVAAQGTAGGVDFTTVVE
PDGMRGHWINVTNELSAALNAKVDDEVDVSLTPTKEWPETSIPDDFGAALEDAPELTEVW
ASLTPMARWEWVRWIQATKNAETRARRVEVAISKLESGKRRPCCFDLASCTDPELAKSGK
LLGIS
Download sequence
Identical sequences A0A1D7W3K4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]