SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D7Z746 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D7Z746
Domain Number 1 Region: 100-400
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 1.82e-53
Family Lambda integrase-like, catalytic core 0.015
Further Details:      
 
Weak hits

Sequence:  A0A1D7Z746
Domain Number - Region: 71-116
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0785
Family Pseudo ankyrin repeat 0.025
Further Details:      
 
Domain Number - Region: 498-537
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0821
Family SinR domain-like 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D7Z746
Sequence length 614
Comment (tr|A0A1D7Z746|A0A1D7Z746_9GAMM) Integrase {ECO:0000313|EMBL:AOR65662.1} KW=Complete proteome OX=1175631 OS=Pectobacterium wasabiae CFBP 3304. GN=A7983_20835 OC=Pectobacteriaceae; Pectobacterium.
Sequence
MVLSAIAVRHAKAIGKAYTLPDDNGLSLSVSPNGGKSWHFRYYWLGKQKRLSLGTYPKVS
LQEARNLRDETKALLDAGINPQSARKQKRYAIQLAVENDFESVFKKWAEYRSLELKEDKK
GTLSQIQRTFNNDILPQIGKMPIYDIRRIDLLKILSKIEQRRAFTTAEKARSWLGQLFRY
AVVKIDGLDVNPAMDLKEVALPKPPEIHNPFLHMSELPSFLSKLRKYSGNETTQLGIRLL
FLTGVRTGELRLATPEQFDLERGLWLIPPEEVKQLQKSMRKNRKRPQDIPPYIVPLSAQA
IEIIRYLIDKVKPAQHYLLPHYYNLQERMSENTLNNALKRMGYKDKLTGHGIRGTISTAL
NEIGYPKVWVDAQLSHADPNKVSSAYNHASYVEPRRRMMQDWADRLDLLEQGFVESAMKH
LTIYIAGIPTMLDTDSNLPIPPVTTTPPAATSTSIVATNDENNNNQTFQRLSPLPPKYSG
KDASEKIITEIQKKRIDMLNIYEKPHNLSVSQFAKLAGKSRDQINREIKANKLLTINIGN
RGQRIPDWQLDPIKKKLIQAVLKSSDKADSWTVYQVLSNRNKILDNQSPIDVVNSKNLDM
IVTIINKVTSTHLF
Download sequence
Identical sequences A0A1D7Z746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]