SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D8MWE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D8MWE5
Domain Number 1 Region: 31-164
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 4.97e-54
Family Ecotin, trypsin inhibitor 0.00000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D8MWE5
Sequence length 167
Comment (tr|A0A1D8MWE5|A0A1D8MWE5_9GAMM) Ecotin {ECO:0000256|HAMAP-Rule:MF_00706} KW=Complete proteome OX=93378 OS=Edwardsiella hoshinae. GN=A9798_04745 OC=Hafniaceae; Edwardsiella.
Sequence
MKTFSMMMAGMLLAASSAAAWADSTDLSRQPLDKIAPYPQAEAGMTRQVIYLPPRADEAD
LRVELLIGKTLSVDCNRQRLMGELDSKTLEGWGYDYLVMEKVTGPVGTMMACPDNQRREA
FVTVHLGDEALQRYNSKLPLVVYVPQGVQVKYRIWQAQAQVQDALSK
Download sequence
Identical sequences A0A1D8MWE5
WP_024523298.1.2897 WP_024523298.1.50131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]