SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D8PNX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1D8PNX3
Domain Number - Region: 81-119
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00107
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D8PNX3
Sequence length 128
Comment (tr|A0A1D8PNX3|A0A1D8PNX3_CANAL) Sdc1p {ECO:0000313|EMBL:AOW29825.1} KW=Complete proteome; Reference proteome OX=237561 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast). GN=CAALFM_C504160WA OC=Candida/Lodderomyces clade; Candida.
Sequence
METPISNQDTAKENLETHANESIDNSDQTENKPTNGSVDEKPQSSNPMEIDTKEESTKSQ
INTPVPNENSQLPMHEIVGGSSVRRYLNQHLTKTLLEGLKEVAQIKPEDPLKYLGEYLIS
KSNKSKKE
Download sequence
Identical sequences A0A1D8PNX3
5476.CAL0002207 XP_721810.1.88832 CA1048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]