SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D9EJN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D9EJN5
Domain Number 1 Region: 64-292
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.17e-23
Family Ankyrin repeat 0.0014
Further Details:      
 
Weak hits

Sequence:  A0A1D9EJN5
Domain Number - Region: 14-85
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0863
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D9EJN5
Sequence length 355
Comment (tr|A0A1D9EJN5|A0A1D9EJN5_XANCG) Uncharacterized protein {ECO:0000313|EMBL:AOY63305.1} KW=Complete proteome OX=1401257 OS=Xanthomonas citri pv. glycines str. 8ra. GN=BHE84_14840 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MDQSIRRNIRQAVKQGGETYVQSLCQAQGDIDAAARYAIEVAIKSGKESLVDQLAPLLSK
SFAVYPLDVAAKAGSARAVEQLMAFCDAENDEALVLAARHGHTECVKRLLKECSPLQGDS
QALYEAARHGHADVVFQLVLFSDAKAQDSRALIAACREGHLEVVKHLLPFSSKIQCAQHG
FAAAAENNHAEVVEFLIEAGLPDPEDTFSLGLNVAAAKGHEQLVRTILWAIVRTGYAPRD
FGEKALFAAATEGDAGMVKSLLEFTHKTAYPEAGLFAALQNGHDEVADLLVRRVNLDHVR
ELISDEEIEAKLDEAIARLDATKQHGELQSNERKRFAQSNTSSSIEKSPARGARL
Download sequence
Identical sequences A0A1D9EJN5
WP_026007255.1.15350 WP_026007255.1.23375 WP_026007255.1.58141 WP_026007255.1.67913 WP_026007255.1.81086 WP_026007255.1.81510 WP_026007255.1.82115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]