SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D9FVA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D9FVA7
Domain Number 1 Region: 13-119
Classification Level Classification E-value
Superfamily XisI-like 1.31e-30
Family XisI-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D9FVA7
Sequence length 120
Comment (tr|A0A1D9FVA7|A0A1D9FVA7_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AOY79297.1} KW=Complete proteome OX=1454205 OS=Moorea producens JHB. GN=BJP36_04580 OC=Oscillatoriaceae; Moorea.
Sequence
METITGVTNCATALIQILKNYCNILNRHKNNSISNTVISKIIVSDDQTRYLVITEGWKDT
QRIHSLIFDAEIRNNKIWLHHDGLDHGITEELLAAGIPKEQIVLAFHPPHIRQHTGYGIS
Download sequence
Identical sequences A0A1D9FVA7
WP_071102800.1.40981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]