SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D9N4S9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D9N4S9
Domain Number 1 Region: 2-44
Classification Level Classification E-value
Superfamily BAS1536-like 0.000000000575
Family BAS1536-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D9N4S9
Sequence length 47
Comment (tr|A0A1D9N4S9|A0A1D9N4S9_CLOPA) Sporulation protein Spo0E {ECO:0000313|EMBL:AOZ79495.1} KW=Complete proteome OX=1501 OS=Clostridium pasteurianum. GN=AQ984_11600 OC=Clostridium.
Sequence
MDNTIEKLREKLHLMLNSDEYNYEEILKVSQQLDKLIVDYYNLQLAH
Download sequence
Identical sequences A0A0H3J5H1 A0A1D9N4S9
WP_034829996.1.15649 WP_034829996.1.61834 WP_034829996.1.63412 WP_034829996.1.65006 WP_034829996.1.70023 WP_034829996.1.82391 WP_034829996.1.85023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]