SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E1EXH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1E1EXH1
Domain Number - Region: 341-393
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000968
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E1EXH1
Sequence length 438
Comment (tr|A0A1E1EXH1|A0A1E1EXH1_9VIRU) Uncharacterized protein {ECO:0000313|EMBL:BAV62943.1} OX=1899318 OS=Acanthamoeba castellanii mimivirus. GN= OC=Viruses; dsDNA viruses, no RNA stage; Mimiviridae; Mimivirus.
Sequence
MPKLSFSDFNDYDNKLKCYLQNKGIEKEFTECKLHGIMNMVDKFNLYNLKDVEQLSFVMW
KLRKYFVKLLHNGYLLTRVNFDMFEKKILEYNSTTRVVRHRGMTPLGGLEVDIDPKIFYL
DCIKFIGQFTNQQEIYDKCLNILENSQKKLSDNYLPSRIMYLMRYNEYVNVNHNKVTENI
FHMNKLSNFYHNVFTITPSQEEQYERYKFEIMEVYHDIARFKSSRYSGQANRIGYVCLTD
IMVKNHYHVIDDTDKISYHTKMFRSTTLDSIISKILCEISDQIILPDEELAARKTARKIE
KKMNNDLRFISKNDKVEILDVFSNAFICVKDIKYDVEILKRDMLIQLYERGIVDPNSDIT
YDLMRNAAENGVLWIVKFLVEKGCPVRNLPPSGNGKKQLHEILTEPVLDDLGFGKKWVAK
QTETRINLLNYLIDNHYI
Download sequence
Identical sequences A0A0G2YED3 A0A0U2UQU6 A0A159ZR17 A0A1E1EXH1 E3VXW0 G8EBS5 J2YW15 Q5UQH2 V5L3J0 W6GI58
YR819_MIMIV YP_003987351.1.55212 gi|311978231|ref|YP_003987351.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]