SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E1IQF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E1IQF2
Domain Number 1 Region: 7-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000107
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0036
Further Details:      
 
Domain Number 2 Region: 69-156
Classification Level Classification E-value
Superfamily EF-hand 0.0000215
Family Polcalcin 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E1IQF2
Sequence length 161
Comment (tr|A0A1E1IQF2|A0A1E1IQF2_LEIGU) Uncharacterized protein {ECO:0000313|EMBL:CCM13441.1} OX=5670 OS=Leishmania guyanensis. GN=BN36_0909550 OC=Leishmaniinae; Leishmania; Leishmania guyanensis species complex.
Sequence
MNAMYSADQINVPPELGTIMKQYTKAVMRDKPTDLYKYSANFFAILSGYATPFDAEGQLT
ENGVSEVPSCSADPVPVEIQEEESADSQDPVDAILRRYDRTGTGYMDPAELPQLLADLRT
SLSLDEKDLDSVEDILAVLPSAHNQIDLLELRSFLFEGVGE
Download sequence
Identical sequences A0A1E1IQF2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]