SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E1KE16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E1KE16
Domain Number 1 Region: 61-120
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000641
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1E1KE16
Sequence length 141
Comment (tr|A0A1E1KE16|A0A1E1KE16_9HELO) Uncharacterized protein {ECO:0000313|EMBL:CZS96303.1} KW=Complete proteome OX=914238 OS=Rhynchosporium agropyri. GN=RAG0_05685 OC=Helotiales; Helotiales incertae sedis; Rhynchosporium.
Sequence
MAANNVLAMRDLATELVSLPGRKQGFVLQALTLWHRVAALVLLDLLGDPAELDHTQTKIS
AIHKVCECGDEGLFDILLEKEANNNYSRGRNEPDVLTVAIQYGHLSMARGLFNNLNYDTR
NSYATCGKKKVLLPRPRQLAL
Download sequence
Identical sequences A0A1E1KE16

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]