SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E1KWC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E1KWC6
Domain Number 1 Region: 141-173
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.0000144
Family Antimicrobial peptide 2, AC-AMP2 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E1KWC6
Sequence length 226
Comment (tr|A0A1E1KWC6|A0A1E1KWC6_9HELO) Uncharacterized protein {ECO:0000313|EMBL:CZT02496.1} KW=Complete proteome; Reference proteome OX=914237 OS=Rhynchosporium commune. GN=RCO7_14695 OC=Helotiales; Helotiales incertae sedis; Rhynchosporium.
Sequence
MSSCSFIRLLVVSLCLISPILARPANDIEDGAAAVRNGPLRSPDRTCGGQMHIPVLVPIA
DHAAHHTASCNSERGWSLRYFGRQEQLVRVGLTKVLAAPAPASAASTQRSAFSLKVANWY
SDPGYNSRFLTPMVEAAGSTNYAYTDSAYGPCCSEAVYCGSAPSYCGYRYRGQADQFWDG
NGLTRSIIMQKPEMATLITTRAYYHSRVRVWTRDTIQSKRHWDARA
Download sequence
Identical sequences A0A1E1KWC6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]