SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E1M759 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E1M759
Domain Number 1 Region: 57-151
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 1.31e-16
Family Substrate-binding domain of HMG-CoA reductase 0.002
Further Details:      
 
Domain Number 2 Region: 138-204
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 0.00000000497
Family NAD-binding domain of HMG-CoA reductase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E1M759
Sequence length 204
Comment (tr|A0A1E1M759|A0A1E1M759_RHYSE) Uncharacterized protein {ECO:0000313|EMBL:CZT44926.1} KW=Complete proteome OX=38038 OS=Rhynchosporium secalis (Barley scald fungus). GN=RSE6_05179 OC=Helotiales; Helotiales incertae sedis; Rhynchosporium.
Sequence
MSISSRTTKEPIIINLIHQPSRTLSLKEEKAASSCLEPSGSLEGIKPDTNLAAQIRSLPN
VSQSPAATSNTKIENCVGFVSVPISFAGPLTLIGTYQTQKTFSAPLATLEPLIVAVCSHG
CKVFSACGGISTSALQEGFFRAAVFTFSNIAQALKFSRQVPTLLTHLQTAAKKASSHGEL
VSGSPRIMGSKVRIKFTYICDDAA
Download sequence
Identical sequences A0A1E1M759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]