SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E2VGM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E2VGM4
Domain Number 1 Region: 99-380
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 3.83e-57
Family Lambda integrase-like, catalytic core 0.0075
Further Details:      
 
Weak hits

Sequence:  A0A1E2VGM4
Domain Number - Region: 48-112
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00144
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E2VGM4
Sequence length 393
Comment (tr|A0A1E2VGM4|A0A1E2VGM4_9ENTR) Integrase {ECO:0000313|EMBL:ODG78121.1} KW=Complete proteome OX=1886517 OS=Shigella sp. FC2928. GN=BFF50_23360 OC=Enterobacteriaceae; Shigella.
Sequence
MPLTVRQIESAKPADKDYKLSDGQGLYLLIKKSGARYWNLKYRFAGKEKKLVIGVYPGIS
LALARQKRDEARKLLAEGKDPSYEKQASKHALRESIACTFCTLAEELFTHMACRWTAGYL
ADQRARFENHINPMLGKRPVADIRPLEILNALRVIEKNGKLEALRKTRQLCSQIFDYAIA
TGRATINPASTLSSVVLHPEKQQRRMLSEEQLGAFMYQMKVSGNFMSLVTQILVLTAVRT
GELRLATWDEIDFTNALWVIPKERMKMRRPHVVPLSHQTQMLLKEIKIITAPRNSELVIP
GVYRDNQPRGRGCINEFLQQVGWHTFTTAHGFRHTFSTILHDHDFSSAWIELQLAHVDKN
IMRGTYNHAQYLDGRREMMQWYADYIDSLSEQA
Download sequence
Identical sequences A0A073FM99 A0A074HM16 A0A080FQ06 A0A086UCP9 A0A0M7P1N7 A0A1E2VGM4 B7MSS6 T6GL11
WP_001131670.1.100052 WP_001131670.1.100151 WP_001131670.1.100959 WP_001131670.1.101694 WP_001131670.1.10496 WP_001131670.1.14935 WP_001131670.1.20575 WP_001131670.1.2755 WP_001131670.1.27618 WP_001131670.1.27691 WP_001131670.1.30554 WP_001131670.1.31675 WP_001131670.1.3469 WP_001131670.1.35127 WP_001131670.1.35204 WP_001131670.1.35253 WP_001131670.1.35258 WP_001131670.1.36334 WP_001131670.1.39325 WP_001131670.1.41063 WP_001131670.1.42209 WP_001131670.1.44759 WP_001131670.1.4576 WP_001131670.1.4593 WP_001131670.1.46643 WP_001131670.1.47024 WP_001131670.1.52853 WP_001131670.1.54188 WP_001131670.1.5479 WP_001131670.1.58449 WP_001131670.1.61517 WP_001131670.1.64458 WP_001131670.1.64712 WP_001131670.1.66001 WP_001131670.1.66624 WP_001131670.1.68793 WP_001131670.1.69390 WP_001131670.1.69438 WP_001131670.1.69643 WP_001131670.1.69832 WP_001131670.1.71912 WP_001131670.1.75100 WP_001131670.1.77253 WP_001131670.1.78955 WP_001131670.1.83205 WP_001131670.1.84060 WP_001131670.1.87655 WP_001131670.1.87914 WP_001131670.1.88793 WP_001131670.1.91893 WP_001131670.1.93453 WP_001131670.1.94438 WP_001131670.1.94738 WP_001131670.1.95364 WP_001131670.1.96114 WP_001131670.1.96417 WP_001131670.1.97248 WP_001131670.1.97418 WP_001131670.1.98480 585397.ECED1_5046 gi|218692579|ref|YP_002400791.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]