SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E3BZW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3BZW2
Domain Number 1 Region: 31-127
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.00000157
Family MW0975(SA0943)-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E3BZW2
Sequence length 149
Comment (tr|A0A1E3BZW2|A0A1E3BZW2_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:ODM26504.1} KW=Complete proteome; Reference proteome OX=1848158 OS=Clostridium sp. Bc-iso-3. GN=A7W90_09880 OC=Clostridium.
Sequence
MLESTIEQVLVTAINQTLCDKDSFLASLRDNIATVINRESDKALANIDKRLEELQTELLK
LATSNADYDKVGDEIHRLRDQKQKLQLENVNREELKKRITDMSTFLKKQSTALAEYDKQL
VRRLIDKVTVFEDKFTVEFKSGVTVDVDE
Download sequence
Identical sequences A0A1E3BZW2
WP_069194784.1.19738 WP_069194784.1.54604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]