SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E3HV48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3HV48
Domain Number 1 Region: 161-263
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000693
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E3HV48
Sequence length 305
Comment (tr|A0A1E3HV48|A0A1E3HV48_9TREE) Uncharacterized protein {ECO:0000313|EMBL:ODN80218.1} KW=Complete proteome; Reference proteome OX=1295531 OS=Cryptococcus depauperatus CBS 7841. GN=L203_05806 OC=Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus.
Sequence
MVTLVQLPKELIQYIHLLSLNPLFPLTSSVIYNSLHRTHSSYIAQYLLSVYSDCGPTELL
VRSLRHPVCDLQAAKAIKRIWNEQREAPTLAFSSVDECKEPCKVSDSHPVDPQHVMGPLL
CCELPRRLFRKPAPPSTPIHSLVRYLFDTYAPSANSHKGYPLCRAVLQSNHTLAKYLLQH
GADPRLKDHMALEIAISMKDLVMVKILIERDPFETKMVCVQPCDENLSRSAKRIKLGDRI
VVNTRMVEAAMKKGANDIVNYLVYDKKVIPPLKSIMNLGETESTKSMPLNKPSSKTKRRR
QVGFR
Download sequence
Identical sequences A0A1E3HV48

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]