SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E3I9Z6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3I9Z6
Domain Number 1 Region: 52-172
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 3.14e-18
Family Steroid-binding domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1E3I9Z6
Sequence length 175
Comment (tr|A0A1E3I9Z6|A0A1E3I9Z6_9TREE) Uncharacterized protein {ECO:0000313|EMBL:ODN84591.1} KW=Complete proteome; Reference proteome OX=1295533 OS=Cryptococcus amylolentus CBS 6039. GN=L202_00507 OC=Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus.
Sequence
MSLNNPLNLLLIPPILYLAYRVFVPADLAEEEPVTEYTPDQYNWLPAKHPDVLCHKKYTP
QELSKYDGVKTQRILLAIMRVGDDGKLNPNGERTVFDVTAGKTFYGPDGVYGNFAGRDAS
RGMAKQSYELDMLVPLEGPLDMLADLTPAEVENMRGWHQHFEGKYIVCGELVDAL
Download sequence
Identical sequences A0A1E3I9Z6 A0A1E3KEY2
XP_018998394.1.6790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]